PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s882291g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family TALE
Protein Properties Length: 533aa    MW: 59423.1 Da    PI: 6.7327
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s882291g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.56.4e-103634001954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yps  ++++LA++ gL+ +qV++WF N R +
  PDK_30s882291g001 363 FEHflHPYPSDVDKQQLARQAGLSRNQVSNWFINARVR 400
                        664559******************************88 PP

2BELL90.22.2e-292402941872
               BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         VdkrY++y++q+q+v++sF+ v+g g+a+pYt lA +a+SrhFrcLkdai +q+
  PDK_30s882291g001 240 WVDKRYNHYCNQMQMVANSFDSVMGFGAAAPYTVLAHRAMSRHFRCLKDAINKQL 294
                        59***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-23178292IPR006563POX domain
PfamPF075265.2E-26240290IPR006563POX domain
PROSITE profilePS5007112.892341404IPR001356Homeobox domain
SMARTSM003891.8E-9344408IPR001356Homeobox domain
CDDcd000864.68E-12344405No hitNo description
SuperFamilySSF466898.13E-17345411IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-28347410IPR009057Homeodomain-like
PfamPF059202.8E-18361400IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MSPTSSASMS HGLHQGITTR QEHQMQHHIA QQSRRDKLRV QGFEATTLHP LDQIEDKRLD  60
LGTFEHARTG NILSDMFNFP AAGLANQISG IDRLPPKPAA EFSSEWYGDK GVVMGGNFSS  120
WGDTVADSAT MQLLLMNMPS QEPHPRSTSF GNGSFSGGVV ENQGLSLSLS SSLHQLEMGG  180
TSLMRNTRFA RAATELLEEV CGVWREQLKE RRFVVLFIFH VVVKLLLKEC AMKKDSLWIW  240
VDKRYNHYCN QMQMVANSFD SVMGFGAAAP YTVLAHRAMS RHFRCLKDAI NKQLKQVCEL  300
LGEKEVGATS GISKGETPRL RLLEQNLRQR RPFQQIGIMD SEAWRPQRGL PERSVNILRA  360
WLFEHFLHPY PSDVDKQQLA RQAGLSRNQV SNWFINARVR LWKPMVEEMY QQEVKEDEED  420
VNEREEANHR RPLSPSHNNS PQGQGPEANA TEGPGAGAGV HQSNDDTILM GIDAPTSAMD  480
VCGTDMEPMD DLCGAAANAA LGSGMRLGAT GDVSLTLGLR HAGNLPERNW FYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-17350408563Homeobox protein Meis2
3k2a_B4e-17350408563Homeobox protein Meis2
4xrm_A4e-17350408563Homeobox protein Meis2
4xrm_B4e-17350408563Homeobox protein Meis2
4xrs_A3e-17350407158Homeobox protein Meis1
4xrs_B3e-17350407158Homeobox protein Meis1
5bng_A3e-17350408159Homeobox protein Meis2
5bng_B3e-17350408159Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008808897.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-109BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLM0TL801e-144M0TL80_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27440_0011e-144(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-100BEL1-like homeodomain 4